Proteintech, 17096-1-AP, SPHK2 Polyclonal antibody

Size: 20ul / 150ul The SPHK2 (17096-1-AP) by Proteintech is a Polyclonal antibody targeting SPHK2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 17096-1-AP targets SPHK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse brain tissue, human kidney tissue, A549 cells, mouse heart tissue, rat brain tissue, Raji cells, HCT 116 cells, mouse kidney tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human breast cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue, rat kidney tissue, rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10569 Product name: Recombinant human SPHK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-618 aa of BC010671 Sequence: LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP Predict reactive species Full Name: sphingosine kinase 2 Calculated Molecular Weight: 618 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC010671 Gene Symbol: SPHK2 Gene ID (NCBI): 56848 RRID: AB_10598479 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.