Iright
BRAND / VENDOR: Proteintech

Proteintech, 17100-1-AP, DGAT2 Polyclonal antibody

CATALOG NUMBER: 17100-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DGAT2 (17100-1-AP) by Proteintech is a Polyclonal antibody targeting DGAT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17100-1-AP targets DGAT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse adipose tissue, L02 cells, MCF-7 cells, Neuro-2a cells, mouse heart tissue, mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Diacylglycerol acyltransferase 2 (DGAT2) is an integral membrane protein and major enzyme that catalyzes the final step of triacylglycerol (TG) synthesis in eukaryotes (PMID: 21680734). DGAT2 is present in mitochondria-associated membranes, specialized domains of the ER that are highly enriched in lipid synthetic enzymes (PMID: 19049983). DGAT2 isoforms (39 kDa, 44kDa) have major differences in acyl-CoA substrate specificity toward erucoyl-CoA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10719 Product name: Recombinant human DGAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-388 aa of BC015234 Sequence: DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN Predict reactive species Full Name: diacylglycerol O-acyltransferase homolog 2 (mouse) Calculated Molecular Weight: 388 aa, 44 kDa Observed Molecular Weight: 39~44kDa GenBank Accession Number: BC015234 Gene Symbol: DGAT2 Gene ID (NCBI): 84649 RRID: AB_2918049 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924