Proteintech, 17120-1-AP, PIGX Polyclonal antibody

Size: 20ul / 150ul The PIGX (17120-1-AP) by Proteintech is a Polyclonal antibody targeting PIGX in WB, ELISA applications with reactivity to human, mouse, rat samples 17120-1-AP targets PIGX in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293K cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PIGX encodes a 258-amino acid ER-resident type I transmembrane protein with a large lumenal domain. It acts by stabilizing the mannosyltransferase PIGM. PIGX might function as a cyclic dimeric GMP phosphodiesterase. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10808 Product name: Recombinant human PIGX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC022542 Sequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALDNEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class X Calculated Molecular Weight: 217aa,25 kDa; 258aa,29 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC022542 Gene Symbol: PIGX Gene ID (NCBI): 54965 RRID: AB_3669260 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TBF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.