Iright
BRAND / VENDOR: Proteintech

Proteintech, 17160-1-AP, C4 Gamma Chain Polyclonal antibody

CATALOG NUMBER: 17160-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C4 Gamma Chain (17160-1-AP) by Proteintech is a Polyclonal antibody targeting C4 Gamma Chain in WB, IHC, ELISA applications with reactivity to human samples 17160-1-AP targets C4 Gamma Chain in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular weights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4A protein recognizes the C4 gamma chain. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10449 Product name: Recombinant human C4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC012372 Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV Predict reactive species Full Name: complement component 4A (Rodgers blood group) Calculated Molecular Weight: 1744 aa, 193 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC012372 Gene Symbol: C4 Gamma Chain Gene ID (NCBI): 720 RRID: AB_2923565 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0C0L4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924