Proteintech, 17164-1-AP, GBA2 Polyclonal antibody

Size: 20ul / 150ul The GBA2 (17164-1-AP) by Proteintech is a Polyclonal antibody targeting GBA2 in WB, ELISA applications with reactivity to human, mouse, rat samples 17164-1-AP targets GBA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, HeLa cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GBA2(Non-lysosomal glucosylceramidase) is also named as KIAA1605,NLGase and belongs to the non-lysosomal glucosylceramidase family.It catalyzes the conversion of glucosylceramide to free glucose and ceramide and is involved in sphingomyelin generation and prevention of glycolipid accumulation.GBA2 contains a putative membrane-spanning domain and 2 potential N-glycosylation sites. However, glycosidase treatment indicated that GBA2 is not a glycoprotein(PMID:11489889).It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10606 Product name: Recombinant human GBA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 574-927 aa of BC011363 Sequence: RRYLMSGVMAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTQHVVRALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASWPKVKQGTGLRTGPMFGPKEAMANLSPE Predict reactive species Full Name: glucosidase, beta (bile acid) 2 Calculated Molecular Weight: 927 aa, 105 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC011363 Gene Symbol: GBA2 Gene ID (NCBI): 57704 RRID: AB_2109077 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.