Proteintech, 17171-1-AP, PSCA Polyclonal antibody

Size: 20ul / 150ul The PSCA (17171-1-AP) by Proteintech is a Polyclonal antibody targeting PSCA in WB, ELISA applications with reactivity to human, mouse samples 17171-1-AP targets PSCA in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, PC-3 cells, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Prostate stem cell antigen (PSCA) is a protein composed of 123 amino acid residues. PSCA belongs to the LY-6/Thy-1 family of cell surface antigens. It is highly expressed in normal prostate and further up-regulated in prostate cancer, as well as non-prostatic malignancies including gastric cancer. PSCA plays a critical role in cell adhesion, proliferation, and survival. The obasrved MW of PSCA is between 36 to 40 kDa in paper (PMID: 11309275). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10710 Product name: Recombinant human PSCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023582 Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHAL Predict reactive species Full Name: prostate stem cell antigen Calculated Molecular Weight: 123 aa, 13 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC023582 Gene Symbol: PSCA Gene ID (NCBI): 8000 RRID: AB_2172635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.