Iright
BRAND / VENDOR: Proteintech

Proteintech, 17185-1-AP, G-CSF Polyclonal antibody

CATALOG NUMBER: 17185-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The G-CSF (17185-1-AP) by Proteintech is a Polyclonal antibody targeting G-CSF in WB, FC (Intra), ELISA applications with reactivity to human samples 17185-1-AP targets G-CSF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MOLT-4 cells, MCF-7 cells, K-562 cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Granulocyte colony-stimulating factor (G-CSF), also referred to as CSF3, is a protective cytokine with anti-inflammatory effects. G-CSF is important in promoting survival of the granulocytic lineage cells and proliferation and migration of neutrophils as well as trophoblast cells. G-CSF acts by binding to its receptor G-CSFR (also called CSF3R), which after binding with G-CSF activates the canonical Janus kinase (Jak)/signal transducer, activator of transcription (STAT)and Ras/Raf/MAP kinase pathways. G-CSF potently stimulates the proliferation and release of peripheral blood progenitor cells into the bloodstream and is therefore used to treat neutropenia after chemotherapy. Furthermore, G-CSF levels are elevated upon intensive exercise leading to increased neutrophil counts, which are predominantly due to delayed neutrophil apoptosis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10968 Product name: Recombinant human G-CSF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC033245 Sequence: MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Predict reactive species Full Name: colony stimulating factor 3 (granulocyte) Calculated Molecular Weight: 200 aa, 22 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC033245 Gene Symbol: G-CSF Gene ID (NCBI): 1440 RRID: AB_2878357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09919 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924