Iright
BRAND / VENDOR: Proteintech

Proteintech, 17197-1-AP, WDFY2 Polyclonal antibody

CATALOG NUMBER: 17197-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WDFY2 (17197-1-AP) by Proteintech is a Polyclonal antibody targeting WDFY2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 17197-1-AP targets WDFY2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L-929 cells, 3T3-L1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WDFY2, also named Prof, is a protein that contains WD repeats and an FYVE domain. WDFY2 regulates the membrane-bound matrix metalloproteinase MT1-MMP (MMP14) efflux by controlling endosome sorting. WDFY2 may act as a tumor suppressor by limiting VAMP3-dependent recycling to inhibit matrix metalloproteinase secretion and cell invasion (PMID: 31253801). WDFY2 in the cell nucleus directly participates in homologous recombination-mediated DNA repair (PMID: 41196680). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10415 Product name: Recombinant human WDFY2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-400 aa of BC014004 Sequence: SCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS Predict reactive species Full Name: WD repeat and FYVE domain containing 2 Calculated Molecular Weight: 400 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC014004 Gene Symbol: WDFY2 Gene ID (NCBI): 115825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P53 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924