Proteintech, 17201-1-AP, PLXNA4 Polyclonal antibody

Size: 20ul / 150ul The PLXNA4 (17201-1-AP) by Proteintech is a Polyclonal antibody targeting PLXNA4 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17201-1-AP targets PLXNA4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PLXNA4 is a plexin family receptor that transduces semaphorin signals to regulate axon guidance, vascular development, and immune cell migration. It functions as a plasma membrane receptor with intracellular GTPase-regulatory activity, linking extracellular cues to cytoskeletal remodeling. Dysregulation of PLXNA4 has been associated with neurological disease (including Alzheimer's), cancer progression, and vascular/immune dysfunction, making it a multifunctional receptor of significant biomedical interest. (PMID: 27127761) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10978 Product name: Recombinant human PLXNA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC028744 Sequence: MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERTGHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIF Predict reactive species Full Name: plexin A4 Calculated Molecular Weight: 522aa,58 kDa; 1894aa,212 kDa Observed Molecular Weight: 212 kDa GenBank Accession Number: BC028744 Gene Symbol: PLXNA4 Gene ID (NCBI): 91584 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.