Proteintech, 17207-1-AP, LYZL1 Polyclonal antibody

Size: 20ul / 150ul The LYZL1 (17207-1-AP) by Proteintech is a Polyclonal antibody targeting LYZL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17207-1-AP targets LYZL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human testis tissue, human lung tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:100-1:500 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LYZL1(Lysozyme-like 1) is also named as LYC2 and belongs to the glycosyl hydrolase 22 family. It is involved in the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. LYZL1 has two isoforms with the molecular weight of 17 kDa and 22 kDa. The full length protein has a signal peptide of 19 amino acids and a glycosylation site. This antibody detects the N-terminal of LYZL1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10986 Product name: Recombinant human LYZL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC021730 Sequence: MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS Predict reactive species Full Name: lysozyme-like 1 Calculated Molecular Weight: 194 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC021730 Gene Symbol: LYZL1 Gene ID (NCBI): 84569 RRID: AB_2138916 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UWQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.