Iright
BRAND / VENDOR: Proteintech

Proteintech, 17226-1-AP, USHBP1 Polyclonal antibody

CATALOG NUMBER: 17226-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The USHBP1 (17226-1-AP) by Proteintech is a Polyclonal antibody targeting USHBP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17226-1-AP targets USHBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, COLO 320 cells, mouse heart tissue Positive IHC detected in: human heart tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information USHBP1, also named as Mutated in colon cancer protein 2 or AIE-75-binding protein, is a 703 amino acid protein, which belongs to the MCC family. Highest level of expression is in heart, and moderate to low expression in skeletal muscle, kidney, liver, small intestine, placenta and lung. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11064 Product name: Recombinant human USHBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 354-703 aa of BC027910 Sequence: EAYRVLLALREADSGAGDEAPMSDLQAAEKEAWRLLAQEEAAMDAGAQQNPQPSPEGSSVDKPTPQEVAFQLRSYVQRLQERRSLMKILSEPGPTLAPMPTVPRAEAMVQAILGTQAGPALPRLEKTQIQQDLVAAREALADLMLRLQLVRREKRGLELREAALRALGPAHVLLLEQLRWERAELQAGGANSSGGHSSGGGSSGDEEEWYQGLPAVPGGTSGIDGGQVGRAWDPEKLAQELAASLTRTLDLQEQLQSLRRELEQVAQKGRARRSQSAELNRDLCKAHSALVLAFRGAHRKQEEQRRKLEQQMALMEAQQAEEVAVLEATARALGKPRPPLPPPQLGDTFL Predict reactive species Full Name: Usher syndrome 1C binding protein 1 Calculated Molecular Weight: 703 aa, 76 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC027910 Gene Symbol: USHBP1 Gene ID (NCBI): 83878 RRID: AB_2878364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6Y0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924