Proteintech, 17228-1-AP, Granzyme H Polyclonal antibody

Size: 20ul / 150ul The Granzyme H (17228-1-AP) by Proteintech is a Polyclonal antibody targeting Granzyme H in WB, ELISA applications with reactivity to human samples 17228-1-AP targets Granzyme H in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Granzyme H (GzmH) belongs to a family of 5 human serine proteases that are expressed by cytotoxic immune effector cells. It's regarded as an orphan granzyme with unknown biologic functions in immune defense cells. It's reported that this serine protease is predominantly expressed at high levels in natural killer (NK) cells and has chymotrypsin-like (chymase) activity. The calculated molecular weight is 27 kDa, 17228-1-AP can detect a band around 30 kDa. (PMID: 17409270) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11069 Product name: Recombinant human GZMH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC027974 Sequence: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL Predict reactive species Full Name: granzyme H (cathepsin G-like 2, protein h-CCPX) Calculated Molecular Weight: 246 aa, 27 kDa Observed Molecular Weight: ~30 kDa GenBank Accession Number: BC027974 Gene Symbol: Granzyme H Gene ID (NCBI): 2999 RRID: AB_3085518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.