Proteintech, 17264-1-AP, MITD1 Polyclonal antibody

Size: 20ul / 150ul The MITD1 (17264-1-AP) by Proteintech is a Polyclonal antibody targeting MITD1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17264-1-AP targets MITD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MOLT-4 cells, mouse kidney tissue, rat kidney tissue, rat brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10998 Product name: Recombinant human MITD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC018453 Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI Predict reactive species Full Name: MIT, microtubule interacting and transport, domain containing 1 Calculated Molecular Weight: 249 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC018453 Gene Symbol: MITD1 Gene ID (NCBI): 129531 RRID: AB_2297522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WV92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.