Iright
BRAND / VENDOR: Proteintech

Proteintech, 17273-1-AP, PUS7L Polyclonal antibody

CATALOG NUMBER: 17273-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PUS7L (17273-1-AP) by Proteintech is a Polyclonal antibody targeting PUS7L in WB, ELISA applications with reactivity to human samples 17273-1-AP targets PUS7L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells, HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11030 Product name: Recombinant human PUS7L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-701 aa of BC033621 Sequence: KVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLKKQINDSANLRERIMEAIENVKKKGFVNYYGPQRFGKGRKVHTDQIGLALLKNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSLMPEFKVRERALLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETYGARVVQGDLVCLDEDIDDENFPNSKIHLVTEEEGSANMYAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKVPTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHDV Predict reactive species Full Name: pseudouridylate synthase 7 homolog (S. cerevisiae)-like Calculated Molecular Weight: 701 aa, 81 kDa Observed Molecular Weight: 81, 45 kDa GenBank Accession Number: BC033621 Gene Symbol: PUS7L Gene ID (NCBI): 83448 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0K6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924