Proteintech, 17274-1-AP, DZIP1L Polyclonal antibody

Size: 20ul / 150ul The DZIP1L (17274-1-AP) by Proteintech is a Polyclonal antibody targeting DZIP1L in WB, IHC, ELISA applications with reactivity to human, mouse samples 17274-1-AP targets DZIP1L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, NIH/3T3 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DZIP1L, or DAZ interacting zinc finger protein 1-like, is a protein implicated in autosomal recessive polycystic kidney disease (ARPKD). DZIP1L has been shown to localize to centrioles and at the distal end of basal bodies, interacting with septin2, a protein that maintains the periciliary diffusion barrier at the ciliary transition zone (PMID: 28530676). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11034 Product name: Recombinant human DZIP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-767 aa of BC033308 Sequence: KAVDTEEDSPEEEMEDSQDEQHKVLAALRRNPTLLKHFRPILEDTLEEKLESMGIRKDAKGISIQTLRHLESLLRVQREQKARKFSEFLSLRGKLVKEVTSRAKERQENGAAVSQPDGQPSVKSQQSALVTREAQPKTRTLQVALPSTPAEPPPPTRQSHGSHGSSLTQVSAPAPHPGLHGPSSTPPSSGPGMSTPPFSSEEDSEGDRVQRVSLQPPKVPSRMVPRPKDDWDWSDTETSEENAQPPGQGSGTLVQSMVKNLEKQLEAPAKKPAGGVSLFFMPNAGPQRAATPGRKPQLSEDESDLEISSLEDLPLDLDQREKPKPLSRSKLPEKFGTGPQSSGQPRVPAW Predict reactive species Full Name: DAZ interacting protein 1-like Calculated Molecular Weight: 767 aa, 87 kDa Observed Molecular Weight: 87 kDa GenBank Accession Number: BC033308 Gene Symbol: DZIP1L Gene ID (NCBI): 199221 RRID: AB_3669266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.