Proteintech, 17275-1-AP, CALML3 Polyclonal antibody

Size: 20ul / 150ul The CALML3 (17275-1-AP) by Proteintech is a Polyclonal antibody targeting CALML3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 17275-1-AP targets CALML3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IP detected in: A431 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11037 Product name: Recombinant human CALML3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC031889 Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK Predict reactive species Full Name: calmodulin-like 3 Calculated Molecular Weight: 149 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC031889 Gene Symbol: CALML3 Gene ID (NCBI): 810 RRID: AB_2878374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27482 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.