Proteintech, 17294-1-AP, TRMT10A Polyclonal antibody

Size: 20ul / 150ul The TRMT10A (17294-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT10A in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17294-1-AP targets TRMT10A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TRMT10A is a tRNA methyltransferase responsible for catalyzing the formation of N1-methylguanosine (m1G) at position 9 (m1G9) in tRNAs. Deficiencies in TRMT10A function have been linked to developmental disorders, including intellectual disability and microcephaly. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11172 Product name: Recombinant human RG9MTD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-339 aa of BC028373 Sequence: MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH Predict reactive species Full Name: RNA (guanine-9-) methyltransferase domain containing 2 Calculated Molecular Weight: 339 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC028373 Gene Symbol: RG9MTD2 Gene ID (NCBI): 93587 RRID: AB_2878377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TBZ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.