Iright
BRAND / VENDOR: Proteintech

Proteintech, 17328-1-AP, GSG1L Polyclonal antibody

CATALOG NUMBER: 17328-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GSG1L (17328-1-AP) by Proteintech is a Polyclonal antibody targeting GSG1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17328-1-AP targets GSG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, U-251 cells, SGC-7901 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GSG1L is a component of the inner core of AMPAR complex. It modifies AMPA receptor (AMPAR) gating. GSG1L is mainly present on B lymphocytes. This antibody can recognize all the 4 isoforms of GSG1L. GSG1L was detected the isoform of 43 kDa in rat brain (PMID: 22813734). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11307 Product name: Recombinant human GSG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC016460 Sequence: MCLELFHSSNVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV Predict reactive species Full Name: GSG1-like Calculated Molecular Weight: 176 aa, 21 kDa Observed Molecular Weight: 36-43 kDa GenBank Accession Number: BC016460 Gene Symbol: GSG1L Gene ID (NCBI): 146395 RRID: AB_2878384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924