Proteintech, 17351-1-AP, ASTN2 Polyclonal antibody

Size: 20ul / 150ul The ASTN2 (17351-1-AP) by Proteintech is a Polyclonal antibody targeting ASTN2 in WB, ELISA applications with reactivity to human, mouse, rat samples 17351-1-AP targets ASTN2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ASTN2, also named as KIAA0634, has recently been implicated in several common disorders of the nervous system, including attention deficit hyperactivity disorder (ADHD), autism and schizophrenia. Astn2 is abundant in migrating cerebellar granule neurons when glial-guided migration is ongoing. ASTN2 forms a complex with ASTN1 that regulates the polarized trafficking of ASTN1 during migration. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11425 Product name: Recombinant human ASTN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-440 aa of BC029272 Sequence: MNTLLCKGMFCLLSWEADSRGRLGEYTLQPLSLQTEETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKIMCEEKMVSMARNTYGESKGR Predict reactive species Full Name: astrotactin 2 Calculated Molecular Weight: 440 aa, 50 kDa Observed Molecular Weight: 148 kDa GenBank Accession Number: BC029272 Gene Symbol: ASTN2 Gene ID (NCBI): 23245 RRID: AB_2878394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75129 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.