Proteintech, 17365-1-AP, AP1S3 Polyclonal antibody

Size: 20ul / 150ul The AP1S3 (17365-1-AP) by Proteintech is a Polyclonal antibody targeting AP1S3 in IHC, ELISA applications with reactivity to human, mouse samples 17365-1-AP targets AP1S3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AP1S3 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes small subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10751 Product name: Recombinant human AP1S3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-104 aa of BC021898 Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA Predict reactive species Full Name: adaptor-related protein complex 1, sigma 3 subunit Calculated Molecular Weight: 104aa,11 kDa; 154aa,18 kDa GenBank Accession Number: BC021898 Gene Symbol: AP1S3 Gene ID (NCBI): 130340 RRID: AB_3085522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.