Iright
BRAND / VENDOR: Proteintech

Proteintech, 17366-1-AP, TNFAIP8L1 Polyclonal antibody

CATALOG NUMBER: 17366-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TNFAIP8L1 (17366-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP8L1 in IHC, IP, ELISA applications with reactivity to human, mouse samples 17366-1-AP targets TNFAIP8L1 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TNFAIP8L1, also known as TIPE1, is a member of the TNFAIP8 family. TNFAIP8L1 possesses anti-apoptotic and pro-tumorigenic properties, which are crucial for tumor initiation and progression as well as the immune system's ability to combat cancer. TNFAIP8L1 is highly expressed in most cancer cell lines, particularly in cells transformed by viral genomes. The calculated molecular weight of TNFAIP8L1 is 21 kDa. (PMID: 36254562, PMID: 38065896, PMID: 21600655) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10778 Product name: Recombinant human TNFAIP8L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC017672 Sequence: MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAVGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 8-like 1 Calculated Molecular Weight: 186 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC017672 Gene Symbol: TNFAIP8L1 Gene ID (NCBI): 126282 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVP5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924