Proteintech, 17368-1-AP, SNRPA1 Polyclonal antibody

Size: 20ul / 150ul The SNRPA1 (17368-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPA1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 17368-1-AP targets SNRPA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, Raji cells Positive IP detected in: HepG2 cells Positive IHC detected in: human lung tissue, human brain tissue, human kidney tissue, human liver tissue, human ovary tissue, human placenta tissue, human spleen tissue, human stomach cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Small nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10790 Product name: Recombinant human SNRPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC022816 Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide A' Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC022816 Gene Symbol: SNRPA1 Gene ID (NCBI): 6627 RRID: AB_2193724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09661 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.