Proteintech, 17387-1-AP, SAMD4A Polyclonal antibody

Size: 20ul / 150ul The SAMD4A (17387-1-AP) by Proteintech is a Polyclonal antibody targeting SAMD4A in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 17387-1-AP targets SAMD4A in WB, IHC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human spleen tissue, human kidney tissue, human lung tissue, human ovary tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11273 Product name: Recombinant human SAMD4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-383 aa of BC021726 Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI Predict reactive species Full Name: sterile alpha motif domain containing 4A Calculated Molecular Weight: 529 aa, 59 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC021726 Gene Symbol: SAMD4A Gene ID (NCBI): 23034 RRID: AB_2301339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.