Proteintech, 17436-1-AP, Leptin Polyclonal antibody

Size: 20ul / 150ul The Leptin (17436-1-AP) by Proteintech is a Polyclonal antibody targeting Leptin in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17436-1-AP targets Leptin in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach tissue, human liver tissue, human ovary tissue, human placenta tissue, human testis tissue, mouse ovary tissue, mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Leptin is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. Leptin is the most critical hormone in the homeostatic regulation of energy balance among those so far discovered. Leptin primarily acts on the neurons of the mediobasal part of hypothalamus to regulate food intake, thermogenesis, and the blood glucose level. Leptin also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. Leptin has also been linked to type 2 diabetes mellitus development. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11507 Product name: Recombinant human LEP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC060830 Sequence: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC Predict reactive species Full Name: leptin Calculated Molecular Weight: 167 aa, 19 kDa GenBank Accession Number: BC060830 Gene Symbol: Leptin Gene ID (NCBI): 3952 RRID: AB_2265702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.