Proteintech, 17467-1-AP, FKBP11 Polyclonal antibody

Size: 20ul / 150ul The FKBP11 (17467-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP11 in WB, ELISA applications with reactivity to human samples 17467-1-AP targets FKBP11 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information FKBP11 (FK506 binding protein 11, also named FKBP19) was first described as predominantly expressed in secretory tissues including the pancreas and recent studies have suggested a role in beta cell survival under conditions of ER stress (PMID: 35456020). In addition, FKBP11 appears to play a role in osteoblasts and bone formation where it has been observed to associate with interferon-inducible transmembrane protein 5 (IFITM5) (PMID: 24058703). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11368 Product name: Recombinant human FKBP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-201 aa of BC027973 Sequence: AEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK Predict reactive species Full Name: FK506 binding protein 11, 19 kDa Calculated Molecular Weight: 201 aa, 22 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC027973 Gene Symbol: FKBP11 Gene ID (NCBI): 51303 RRID: AB_3669276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.