Iright
BRAND / VENDOR: Proteintech

Proteintech, 17471-1-AP, RNF32 Polyclonal antibody

CATALOG NUMBER: 17471-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RNF32 (17471-1-AP) by Proteintech is a Polyclonal antibody targeting RNF32 in WB, ELISA applications with reactivity to human, mouse, rat samples 17471-1-AP targets RNF32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Ring Finger Protein 32 (RNF32) is a member of the RING finger protein family, characterized by a RING domain that functions as an E3 ubiquitin ligase. RNF32 is specifically expressed in testis and ovary. Studies indicate that RNF32 is expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids, suggesting a possible role in sperm formation (PMID: 11890671, PMID: 41167191). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11428 Product name: Recombinant human RNF32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-221 aa of BC028120 Sequence: NKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLR Predict reactive species Full Name: ring finger protein 32 Calculated Molecular Weight: 362 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC028120 Gene Symbol: RNF32 Gene ID (NCBI): 140545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924