Proteintech, 17479-1-AP, YTHDF1 Polyclonal antibody

Size: 20ul / 150ul The YTHDF1 (17479-1-AP) by Proteintech is a Polyclonal antibody targeting YTHDF1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 17479-1-AP targets YTHDF1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, mouse brain tissue, rat brain tissue, HEK-293 cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissue, human hypothalamus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information YTHDF1, also named YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at the internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoforms and the calculated molecular weight of isoforms are 61 kDa and 21 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, chicken, zebrafish, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11509 Product name: Recombinant human YTHDF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-559 aa of BC050284 Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ Predict reactive species Full Name: YTH domain family, member 1 Calculated Molecular Weight: 559 aa, 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC050284 Gene Symbol: YTHDF1 Gene ID (NCBI): 54915 RRID: AB_2217473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.