Proteintech, 17503-1-AP, GNG11 Polyclonal antibody

Size: 20ul / 150ul The GNG11 (17503-1-AP) by Proteintech is a Polyclonal antibody targeting GNG11 in WB, ELISA applications with reactivity to human, mouse, rat samples 17503-1-AP targets GNG11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 (GBG11) is a subunit of Guanine nucleotide-binding proteins (G proteins). G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11698 Product name: Recombinant human GNG11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009709 Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma 11 Calculated Molecular Weight: 73 aa, 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC009709 Gene Symbol: GNG11 Gene ID (NCBI): 2791 RRID: AB_2109758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.