Iright
BRAND / VENDOR: Proteintech

Proteintech, 17532-1-AP, CTDSPL2 Polyclonal antibody

CATALOG NUMBER: 17532-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CTDSPL2 (17532-1-AP) by Proteintech is a Polyclonal antibody targeting CTDSPL2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17532-1-AP targets CTDSPL2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, HeLa cells, HepG2 cells, human brain tissue, mouse eye tissue, mouse testis tissue, Y79 cells Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CTD small phosphatase-like protein 2 (CTDSPL2) is also named as HSPC058 and HSPC129, belongs to the CTDSPL2 family. It is a putative RNA-polymerase II carboxy-terminal domain (CTD) phosphatase, whose specific CTD phosphatase activity was verified in vitro, and may regulate the dynamic phosphorylation of RNAP II CTD.( PMID: 17487459) It can obviously improve the expression of ε- and γ-globin genes in K562 cells and CD34+ cells derived from UCB.( PMID: 20932329) This antibody is a rabbit polyclonal antibody raised against a region of human CTDSPL2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11581 Product name: Recombinant human CTDSPL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 114-466 aa of BC035744 Sequence: EMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD Predict reactive species Full Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 Calculated Molecular Weight: 466 aa, 53 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC035744 Gene Symbol: CTDSPL2 Gene ID (NCBI): 51496 RRID: AB_2087204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05D32 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924