Iright
BRAND / VENDOR: Proteintech

Proteintech, 17535-1-AP, PARP9 Polyclonal antibody

CATALOG NUMBER: 17535-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PARP9 (17535-1-AP) by Proteintech is a Polyclonal antibody targeting PARP9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 17535-1-AP targets PARP9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Raji cells, THP-1 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse brain tissue, human heart tissue, human kidney tissue, human lung tissue, human lymphoma tissue, human ovary tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Poly(ADP-ribosyl)ation is a post-translational modification of proteins mediated by one of the 17 members of the poly(ADP-ribose) polymerases (PARP). PARP-9 belongs to the subfamily of macroPARPs, associating one to three macro domains to the PARP domain. Overexpression of PARP-9 stimulates cell migration in vitro, suggesting a role for PARP-9 in the promotion of malignant B cell migration and dissemination in high risk DLBCL. PARP-9 is also likely a transcription coactivator, its overexpression in B lymphocytes, stimulated by IFNγ, inducing the transcription of IFNγ-controlled genes. Specification Tested Reactivity: human, rat Cited Reactivity: human, treeshrew Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11587 Product name: Recombinant human PARP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-819 aa of BC039580 Sequence: EARSPAINLMGFNVEEMYEAHAWIQRILSLQNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNIEDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 9 Calculated Molecular Weight: 819 aa, 92 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC039580 Gene Symbol: PARP9 Gene ID (NCBI): 83666 RRID: AB_2158929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924