Proteintech, 17574-1-AP, NRSN2 Polyclonal antibody

Size: 20ul / 150ul The NRSN2 (17574-1-AP) by Proteintech is a Polyclonal antibody targeting NRSN2 in WB, IHC, ELISA applications with reactivity to human samples 17574-1-AP targets NRSN2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10387 Product name: Recombinant human NRSN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC001963 Sequence: MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS Predict reactive species Full Name: neurensin 2 Calculated Molecular Weight: 204 aa, 22 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC001963 Gene Symbol: NRSN2 Gene ID (NCBI): 80023 RRID: AB_2155379 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.