Iright
BRAND / VENDOR: Proteintech

Proteintech, 17598-1-AP, MED20 Polyclonal antibody

CATALOG NUMBER: 17598-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MED20 (17598-1-AP) by Proteintech is a Polyclonal antibody targeting MED20 in WB, ELISA applications with reactivity to human samples 17598-1-AP targets MED20 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MED20(Mediator of RNA polymerase II transcription subunit 20) is also named as TRFP and belongs to the Mediator complex subunit 20 family. The deduced 209-amino acid protein shares 44% amino identity with Drosophila Trfp. TRFP had an apparent molecular mass of 28 kD by SDS-PAGE. It is identified TRFP as a component of an RNA polymerase II-SRB complex. The TRFP-containing complex could substitute for core RNA polymerase II in driving basal transcription from a minimal promoter. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11598 Product name: Recombinant human MED20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC040950 Sequence: MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR Predict reactive species Full Name: mediator complex subunit 20 Calculated Molecular Weight: 212 aa, 23 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC040950 Gene Symbol: MED20 Gene ID (NCBI): 9477 RRID: AB_2142162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H944 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924