Proteintech, 17617-1-AP, CD3 Polyclonal antibody

Size: 20ul / 150ul The CD3 (17617-1-AP) by Proteintech is a Polyclonal antibody targeting CD3 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 17617-1-AP targets CD3 in WB, IHC, IF-P, IF-Fro, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Jurkat cells, pig spleen tissue, MOLT-4 cells, mouse thymus tissue, rat thymus tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissue, mouse spleen tissue, human lymphoma tissue, human lung cancer tissue, human breast cancer tissue, mouse colon tissue, human pancreas cancer tissue, rat thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, mouse spleen tissue Positive IF-Fro detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a polyclonal antibody directed against the epsilon chain of human CD3 molecule. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species Full Name: CD3e molecule, epsilon (CD3-TCR complex) Calculated Molecular Weight: 207 aa, 23 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC049847 Gene Symbol: CD3 Gene ID (NCBI): 916 ENSEMBL Gene ID: ENSG00000198851 RRID: AB_1939430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07766 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.