Proteintech, 17626-1-AP, IL-7Ra/CD127 Polyclonal antibody

Size: 20ul / 150ul The IL-7Ra/CD127 (17626-1-AP) by Proteintech is a Polyclonal antibody targeting IL-7Ra/CD127 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse samples 17626-1-AP targets IL-7Ra/CD127 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue, K-562 cells Positive IP detected in: K-562 cells Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11844 Product name: Recombinant human IL-7R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-459 aa of BC067537 Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ Predict reactive species Full Name: interleukin 7 receptor Calculated Molecular Weight: 459 aa, 52 kDa Observed Molecular Weight: 56-58 kDa GenBank Accession Number: BC067537 Gene Symbol: CD127 Gene ID (NCBI): 3575 ENSEMBL Gene ID: ENSG00000168685 RRID: AB_2126105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16871 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.