Proteintech, 17627-1-AP, ASCC3 Polyclonal antibody

Size: 20ul / 150ul The ASCC3 (17627-1-AP) by Proteintech is a Polyclonal antibody targeting ASCC3 in WB, IP, ELISA applications with reactivity to human samples 17627-1-AP targets ASCC3 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11848 Product name: Recombinant human ASCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC050681 Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR Predict reactive species Full Name: activating signal cointegrator 1 complex subunit 3 Calculated Molecular Weight: 111 aa, 13 kDa, 251 kDa Observed Molecular Weight: 251 kDa GenBank Accession Number: BC050681 Gene Symbol: ASCC3 Gene ID (NCBI): 10973 RRID: AB_2059474 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3C0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.