Proteintech, 17648-1-AP, FBXO21 Polyclonal antibody

Size: 20ul / 150ul The FBXO21 (17648-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO21 in WB, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 17648-1-AP targets FBXO21 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IP detected in: A549 cells, rat brain tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FBXO21 (F-box protein 21) is a member of the F-box protein family and serves as the substrate recognition component of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. In AML cells, FBXO21 can ubiquitinate p85α, a regulatory subunit of the PI3K pathway, leading to its degradation. This reduces PI3K signaling, promotes p85α dimerization, and activates ERK, thereby influencing cell proliferation and survival. Silencing FBXO21 in AML cells induces differentiation, inhibits tumor progression, and increases sensitivity to chemotherapeutic agents. FBXO21 can regulate immune responses by ubiquitinating and degrading proteins like ASK1 through pro-inflammatory cytokine pathways. It can also ubiquitinate p85α, affecting CXCL10 expression and modulating immune cell infiltration and anti-tumor activity. In renal cell carcinoma, overexpression of FBXO21 significantly suppresses ccRCC cell proliferation and metastasis both in vitro and in vivo. It may be related to the stromal score and the infiltration levels of immune cells associated with prognosis. Additionally, FBXO21 overexpression increases the expression of key molecules in the CREB pathway. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11882 Product name: Recombinant human FBXO21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-537 aa of BC034045 Sequence: DQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE Predict reactive species Full Name: F-box protein 21 Calculated Molecular Weight: 537 aa, 63 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC034045 Gene Symbol: FBXO21 Gene ID (NCBI): 23014 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.