Iright
BRAND / VENDOR: Proteintech

Proteintech, 17649-1-AP, TIAR Polyclonal antibody

CATALOG NUMBER: 17649-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TIAR (17649-1-AP) by Proteintech is a Polyclonal antibody targeting TIAR in WB, IHC, ELISA applications with reactivity to human samples 17649-1-AP targets TIAR in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TIAR, also named as TIA 1 related protein, is an RNA-binding protein which is associated with apoptosis. It has been shown that mouse with disrupted TIAR gene show high levels of embryonic lethality. TIAR plays an important role in cytoplasm and nucleus where it can control translation of some specific mRNAs and activate splicing of exons with weak 5-splice sites.. Besides, TIAR also has the 28 kDa and 50 kDa proteins for TIAR exists in multiple alternative splicing forms.(PMID: 12533540, 7533298, 22851315, 8176212) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11884 Product name: Recombinant human TIAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-252 aa of BC030025 Sequence: MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ Predict reactive species Full Name: TIA1 cytotoxic granule-associated RNA binding protein-like 1 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 38-43 kDa GenBank Accession Number: BC030025 Gene Symbol: TIAR Gene ID (NCBI): 7073 RRID: AB_3669280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924