Proteintech, 17658-1-AP, LGR6 Polyclonal antibody

Size: 20ul / 150ul The LGR6 (17658-1-AP) by Proteintech is a Polyclonal antibody targeting LGR6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17658-1-AP targets LGR6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, human brain tissue, mouse testis tissue, HeLa cells, LNCaP cells, PC-3 cells Positive IHC detected in: human testis tissue, human spleen tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LGR6 (Leucine-rich repeat-containing G-protein coupled receptor 6) is a seven-transmembrane protein. LGR6 is a high affinity receptor of R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. It potentially functions as a tumor suppressor. (PMID: 20223988; 20417836; 22615920) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11909 Product name: Recombinant human LGR6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC047905 Sequence: MGRPRLTLVCQVSIIISARDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQAL Predict reactive species Full Name: leucine-rich repeat-containing G protein-coupled receptor 6 Calculated Molecular Weight: 915 aa, 99 kDa Observed Molecular Weight: 104 kDa GenBank Accession Number: BC047905 Gene Symbol: LGR6 Gene ID (NCBI): 59352 RRID: AB_2135163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.