Proteintech, 17675-1-AP, CABP7 Polyclonal antibody

Size: 20ul / 150ul The CABP7 (17675-1-AP) by Proteintech is a Polyclonal antibody targeting CABP7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17675-1-AP targets CABP7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CABP7 belongs to the calmodulin superfamily of proteins and harbors 2 high-affinity EF-hand motifs and a C-terminal transmembrane domain. CABP7 controls cytokinesis by modulating phosphatidylinositol 4-phosphate (PI4P) levels in cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11654 Product name: Recombinant human CABP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC051805 Sequence: MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSL Predict reactive species Full Name: calcium binding protein 7 Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC051805 Gene Symbol: CABP7 Gene ID (NCBI): 164633 RRID: AB_3085533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.