Proteintech, 17676-1-AP, OLAH Polyclonal antibody

Size: 20ul / 150ul The OLAH (17676-1-AP) by Proteintech is a Polyclonal antibody targeting OLAH in WB, ELISA applications with reactivity to human samples 17676-1-AP targets OLAH in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, MCF-10A cells, LNCap cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information OLAH protein, also known as oleoyl-ACP hydrolase, is an enzyme involved in fatty acid production. It has been found to play a role in various biological processes and diseases. For instance, placental OLAH levels are altered in fetal growth restriction and preeclampsia, suggesting its potential involvement in placental dysfunction. Additionally, OLAH has been linked to severe respiratory diseases, where it mediates life-threatening inflammation associated with viral infections. Its expression is also associated with fatal outcomes in certain viral infections. These findings highlight the importance of OLAH in both reproductive health and infectious diseases (PMID: 36139751, PMID: 39137778, PMID: 39178832). OLAH has two isoforms with molecular masses of 30 kDa and 36 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11694 Product name: Recombinant human OLAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC050372 Sequence: MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISN Predict reactive species Full Name: oleoyl-ACP hydrolase Calculated Molecular Weight: 265 aa, 30 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC050372 Gene Symbol: OLAH Gene ID (NCBI): 55301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NV23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.