Iright
BRAND / VENDOR: Proteintech

Proteintech, 17684-1-AP, VEZT Polyclonal antibody

CATALOG NUMBER: 17684-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VEZT (17684-1-AP) by Proteintech is a Polyclonal antibody targeting VEZT in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 17684-1-AP targets VEZT in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, human brain tissue, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Vezatin (VEZT) is an adherens junctions transmembrane protein which identified as a putative tumor suppressor. In case of Listeria infection, it promotes bacterial internalization by participating in myosin VIIa recruitment to the entry site. There're two isoforms with calculated MW 89 kDa and 65 kDa. With modification or glycosylation, the MW in Western blot detection will be presented as ~125 kDa and ~89 kDa (PMID: 11080149) or 65-71 kDa and 88-100 kDa (PMID: 20049712). There're some isoforms with MW less than 70 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11786 Product name: Recombinant human VEZT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-731 aa of BC064939 Sequence: VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK Predict reactive species Full Name: vezatin, adherens junctions transmembrane protein Calculated Molecular Weight: 731 aa, 83 kDa Observed Molecular Weight: 89 kDa, 125 kDa GenBank Accession Number: BC064939 Gene Symbol: VEZT Gene ID (NCBI): 55591 RRID: AB_2213139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBM0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924