Proteintech, 17698-1-AP, SNRNP35 Polyclonal antibody

Size: 20ul / 150ul The SNRNP35 (17698-1-AP) by Proteintech is a Polyclonal antibody targeting SNRNP35 in WB, ELISA applications with reactivity to human, mouse, rat samples 17698-1-AP targets SNRNP35 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SNRNP35 is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11954 Product name: Recombinant human SNRNP35 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-246 aa of BC054034 Sequence: MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK Predict reactive species Full Name: small nuclear ribonucleoprotein 35kDa (U11/U12) Calculated Molecular Weight: 246 aa, 29 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC054034 Gene Symbol: SNRNP35 Gene ID (NCBI): 11066 RRID: AB_3085534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16560 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.