Iright
BRAND / VENDOR: Proteintech

Proteintech, 17703-1-AP, REV1 Polyclonal antibody

CATALOG NUMBER: 17703-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The REV1 (17703-1-AP) by Proteintech is a Polyclonal antibody targeting REV1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17703-1-AP targets REV1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Rev1 is a member of the TLS polymerase family and plays a key role in this mutagenic pathway, which allows the bypass of modified DNA bases and respectively, facilitates proliferation even in the presence of extensive DNA damage, such as during chemotherapy. Mutations in human REV1 have been detected in a minority of tumors, and single-nucleotide polymorphisms (SNPs) in the hREV1 gene have been linked to various types of human cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11975 Product name: Recombinant human REV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 764-1114 aa of BC037734 Sequence: SRPSVQSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPTSPDTNKAESSGKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAVQQAESHGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGINLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASASVPKNPLLHLKAAVKEKKRNKKKKTIGSPKRIQSPLNNKLLNSPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISGWLGLC Predict reactive species Full Name: REV1 homolog (S. cerevisiae) Calculated Molecular Weight: 1114 aa, 122 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC037734 Gene Symbol: REV1 Gene ID (NCBI): 51455 RRID: AB_3085535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924