Iright
BRAND / VENDOR: Proteintech

Proteintech, 17712-1-AP, ARFRP1 Polyclonal antibody

CATALOG NUMBER: 17712-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARFRP1 (17712-1-AP) by Proteintech is a Polyclonal antibody targeting ARFRP1 in WB, IHC, ELISA applications with reactivity to human samples 17712-1-AP targets ARFRP1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ARFRP1, or ADP-ribosylation factor-related protein 1, is a small GTPase that is significantly similar to the ARF family of proteins. It plays a crucial role in intracellular membrane trafficking, particularly in post-Golgi membrane trafficking processes. ARFRP1 is primarily associated with the trans-Golgi compartment and the trans-Golgi network (TGN), where it functions as an essential regulatory factor for the targeting of Arl1 and GRIP domain-containing proteins, such as golgin-97 and golgin-245, onto Golgi membranes. Furthermore, ARFRP1 works in concert with Arl1 and GRIP proteins to facilitate the transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, as well as the retrograde transport of TGN38 and Shiga toxin from endosomes back to the TGN. This protein is also known to function upstream of ARL1 and ARL5, coordinating the recruitment of distinct tethering factors, golgins, and GARP, to the TGN. This mechanism is essential for the delivery of retrograde cargos to the TGN, making ARFRP1 a master regulator of retrograde-carrier tethering to the TGN. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12036 Product name: Recombinant human ARFRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC092480 Sequence: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT Predict reactive species Full Name: ADP-ribosylation factor related protein 1 Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC092480 Gene Symbol: ARFRP1 Gene ID (NCBI): 10139 RRID: AB_2289839 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13795 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924