Iright
BRAND / VENDOR: Proteintech

Proteintech, 17728-1-AP, eIF4G2/DAP5 Polyclonal antibody

CATALOG NUMBER: 17728-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The eIF4G2/DAP5 (17728-1-AP) by Proteintech is a Polyclonal antibody targeting eIF4G2/DAP5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 17728-1-AP targets eIF4G2/DAP5 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A172 cells, Jurkat cells, MCF-7 cells, U-87 MG cells, Neuro-2a cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human prostate cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information eIF4G2, also commonly known as DAP5 (Death-Associated Protein 5) or p97, is a crucial and unique member of the eukaryotic translation initiation factor machinery. Unlike its canonical counterpart eIF4G1, which is central to the cap-dependent translation of most cellular mRNAs, eIF4G2/DAP5 functions as a key regulator and facilitator of alternative, cap-independent translation under both normal and stress conditions. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12125 Product name: Recombinant human EIF4G2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-907 aa of BC043149 Sequence: EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD Predict reactive species Full Name: eukaryotic translation initiation factor 4 gamma, 2 Calculated Molecular Weight: 907 aa, 102 kDa Observed Molecular Weight: 98-102 kDa GenBank Accession Number: BC043149 Gene Symbol: EIF4G2 Gene ID (NCBI): 1982 RRID: AB_2095895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78344 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924