Proteintech, 17731-1-AP, ENOPH1 Polyclonal antibody

Size: 20ul / 150ul The ENOPH1 (17731-1-AP) by Proteintech is a Polyclonal antibody targeting ENOPH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17731-1-AP targets ENOPH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells, L02 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12131 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC065815 Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species Full Name: enolase-phosphatase 1 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 29-35 kDa GenBank Accession Number: BC065815 Gene Symbol: ENOPH1 Gene ID (NCBI): 58478 RRID: AB_2099471 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.