Proteintech, 17740-1-AP, SPOPL Polyclonal antibody

Size: 20ul / 150ul The SPOPL (17740-1-AP) by Proteintech is a Polyclonal antibody targeting SPOPL in WB, ELISA applications with reactivity to human samples 17740-1-AP targets SPOPL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Speckle Type POZ Protein Like (SPOPL), a member of the MATH-BTB protein family, was frst identifed in 2010 with 82.6% sequence homology with Speckle-type POZ protein (SPOP). SPOPL is an E3 ubiquitin ligase protein that ubiquitinates and degrades the target protein. SPOPL can be used as a potential prognostic biomarker for glioblastoma multiforme in clinical work and promotes the proliferation and stemness of glioma stem cells by activating the Notch signaling pathway (PMID:37523046). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11951 Product name: Recombinant human SPOPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-392 aa of BC071613 Sequence: MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS Predict reactive species Full Name: speckle-type POZ protein-like Calculated Molecular Weight: 392 aa, 45 kDa Observed Molecular Weight: 39-45 kDa GenBank Accession Number: BC071613 Gene Symbol: SPOPL Gene ID (NCBI): 339745 RRID: AB_3085537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IQ16 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.