Iright
BRAND / VENDOR: Proteintech

Proteintech, 17748-1-AP, POLRMT Polyclonal antibody

CATALOG NUMBER: 17748-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLRMT (17748-1-AP) by Proteintech is a Polyclonal antibody targeting POLRMT in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 17748-1-AP targets POLRMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, COLO 320 cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mitochondrial DNA-dependent RNA polymerase (POLRMT) is responsible for the transcription of mitochondrial genome encoding key components of oxidative phosphorylation. Structurally, POLRMT comprises four main domains: the N-terminal extension, a pentatricopeptide repeat (PPR) domain, the N-terminal domain, and the C-terminal domain(PMID: 33602924). POLRMT requires transcription factor B2M (TFB2M) and transcription factor AM (TFAM) for mitochondrial RNA transcription. POLRMT is overexpressed at both the mRNA and protein level in several cancers, including breast, skin, lung, endometrial cancer, and osteosarcomas(PMID: 37371693). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12012 Product name: Recombinant human POLRMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 879-1230 aa of BC098387 Sequence: LTGRKWWMGAEEPWQTLACCMEVANAVRASDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELSDFPQEFVWEASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEWVTPLGVPVIQPYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS Predict reactive species Full Name: polymerase (RNA) mitochondrial (DNA directed) Calculated Molecular Weight: 1230 aa, 139 kDa Observed Molecular Weight: 130-139 kDa GenBank Accession Number: BC098387 Gene Symbol: POLRMT Gene ID (NCBI): 5442 RRID: AB_3085539 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00411 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924