Proteintech, 17762-1-AP, GM-CSF Polyclonal antibody

Size: 20ul / 150ul The GM-CSF (17762-1-AP) by Proteintech is a Polyclonal antibody targeting GM-CSF in WB, ELISA applications with reactivity to human samples 17762-1-AP targets GM-CSF in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts. GM-CSF is a hematopoietic growth factor that stimulates the development of early erythroid megakaryocytic and eosinophilic progenitor cells (PMID 2990035). GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes (PMID 3021817, 2984574, 6390681). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12142 Product name: Recombinant human CSF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC108724 Sequence: MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE Predict reactive species Full Name: colony stimulating factor 2 (granulocyte-macrophage) Calculated Molecular Weight: 144 aa, 16 kDa Observed Molecular Weight: 15kDa,18 kDa ,22 kDa GenBank Accession Number: BC108724 Gene Symbol: GM-CSF Gene ID (NCBI): 1437 RRID: AB_2276718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04141 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.