Iright
BRAND / VENDOR: Proteintech

Proteintech, 17773-1-AP, CADM2 Polyclonal antibody

CATALOG NUMBER: 17773-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CADM2 (17773-1-AP) by Proteintech is a Polyclonal antibody targeting CADM2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17773-1-AP targets CADM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CADM2, also known as IGSF4D, NECL3, SYNCAM2, is a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. CADM2 is a conserved modular organization comprising three Ig domains, a single transmembrane pass and a short cytoplasmic region containing 4.1 and PDZ binding motifs. CADM2 is a plasma membrane protein that accumulates in several tissues, including those of the central and peripheral nervous system, where it localizes to myelinated axons and in ependymal cells (PMID: 16311015, 17967169). The molecular weight of the CADM2 protein is approximately 50-60 kDa, which is due to N-linked glycosylation (PMID: 17967169, 21456004). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12191 Product name: Recombinant human CADM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-337 aa of BC105999 Sequence: VKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPDHA Predict reactive species Full Name: cell adhesion molecule 2 Calculated Molecular Weight: 404 aa, 44 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC105999 Gene Symbol: CADM2 Gene ID (NCBI): 253559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3J6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924